Activitytracker.getmlspmasterynow.com
Visit activitytracker.getmlspmasterynow.comWe collected the majority of metadata history records for Activitytracker.getmlspmasterynow.com. Activitytracker Get MLSP Masterynow has an elaborated description which rather positively influences the efficiency of search engines index and hence improves positions of the domain. Activitytracker.getmlspmasterynow used to have no keywords and description in 2014 which is the starting point of our analysis, but description was added on January 24, 2023.
Activitytracker.getmlspmasterynow.com metadata updates
Title | Description | Keywords |
---|---|---|
January 24, 2023 MyLeadSystemPRO (MLSP) - We Help Home Business Owners Get Results | My Lead System PRO® (MLSP) |
MLSP is the world's #1 trusted solution since 2008 to help YOU attract fresh leads daily, get sales & signups, and grow YOUR business by leveraging th... |
|
December 11, 2016 Free Presentation |
||
July 07, 2015 Get More Leads, Sign-Up More Reps, and Make More Money in YOUR Business |
||
October 15, 2014 MLSP Mastery |