Kathrynleesmithwhitelineprints.com
Visit kathrynleesmithwhitelineprints.comWe collected one metadata history record for Kathrynleesmithwhitelineprints.com. Kathryn Lee Smith White Line Print S has an elaborated description which rather positively influences the efficiency of search engines index and hence improves positions of the domain.
Kathrynleesmithwhitelineprints.com metadata updates
| Title | Description | Keywords |
|---|---|---|
|
February 03, 2021 Kathryn Lee Smith, white-line woodblock Provincetown print artist. Welcome! |
Provincetown artist Kathryn Lee Smith has been making white-line prints (also known as Provincetown Prints) in the American single-block color woodcut... |
Kathryn Lee Smith, B.J.O. Nordfeldt, Blanche Lazzell, Oliver Chaffee, Ferol Sibley Warthen... |