Pheaseyparkfarmchildrenscentrenursery.co.uk
Visit pheaseyparkfarmchildrenscentrenursery.co.ukWe collected all of metadata history records for Pheaseyparkfarmchildrenscentrenursery.co.uk. Pheasey Park Farm Childrenscentrenursery has a poor description which rather negatively influences the efficiency of search engines index and hence worsens positions of the domain. Pheaseyparkfarmchildrenscentrenursery has neither keywords, nor description at the moment. But the domain used to have both of them in February 26, 2018.
Pheaseyparkfarmchildrenscentrenursery.co.uk metadata updates
Title | Description | Keywords |
---|---|---|
November 01, 2023 Home | Pheasey Park Farm |
||
March 01, 2020 Pheasey Park Farm Children's Centre Nursery |
Our Vision is to develop a learning community where all children enthusiastically participate, excel and are proud of their achievements across the cu... |
Pheasey Park Farm, Children's Centre Nursery, Education, Home |
February 26, 2018 Pheasey Park Farm Childrens Centre Nursery |
Our Vision is to develop a learning community where all children enthusiastically participate, excel and are proud of their achievements across the cu... |
Children's Centre Nursery, Education, Home, Pheasey Park Farm |