updates

Pleasantviewfamilyhealthcare.com

Visit pleasantviewfamilyhealthcare.com

We collected the majority of metadata history records for Pleasantviewfamilyhealthcare.com. Pleasant View Family Healthcare has an elaborated description which rather positively influences the efficiency of search engines index and hence improves positions of the domain. Pleasantviewfamilyhealthcare used to have no keywords and description in 2020 which is the starting point of our analysis, but description was added on December 23, 2021.

Pleasantviewfamilyhealthcare.com metadata updates

Title Description Keywords

December 23, 2021

Pleasant View Family Healthcare - NorthCrest Physician Services

Pleasant View Family Healthcare is a primary care office located at 2546 TN-49 in Pleasant View, Tennessee. Providers treating patients at our office ...

December 21, 2020

PLEASANTVIEWFAMILYHEALTHCARE.COM