Westlakevillagefamilyservices.com
Visit westlakevillagefamilyservices.comWe collected one metadata history record for Westlakevillagefamilyservices.com. Westlake Village Family Services has an elaborated description which rather positively influences the efficiency of search engines index and hence improves positions of the domain.
Westlakevillagefamilyservices.com metadata updates
| Title | Description | Keywords |
|---|---|---|
|
November 28, 2019 Westlake Village Thousand Oaks individual couple family group therapy |
Westlake Village Family Services Michael Kaufman, M.F.T., Psy.D. provides counseling and therapy services in and around ... |
Westlake Village Family Services Michael Kaufman, M.F.T., Psy.D., therapy, therapist, psyc... |